LogoDB OlfactionDB: olfactory receptors and their ligands LogoUnivr LogoDipBiotec
v
Specific Receptor

Olfr558

UniProt
Id
UniProt
Gene Name
Ref #1
Name
Ref #2
Name
Organism FASTA Ortholog
Q8VGZ7Olfr558MOR18-1MmOR7.5.15mus musculus>tr|Q8VGZ7|Q8VGZ7_MOUSE Putative uncharacterized protein OS=Mus musculus GN=Olfr558 PE=2 SV=1
MVGFNSNESSATYFILIGLPGLEEVQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHEP MYIFLCMLSGLDILISTSSMPKMMAIFWFNSTTIQFDACLVQMFAIHSLSGMESTVLLAM AFDRYVAICHPLRHATVLTLPRVAKIGMAAVVRGAVLMAPLPVFIKRLPFCRSNILSHSY CLHQDVMKLACADIRVNIIYGLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFG TCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSLLPVIMANIYLLVPPVLNPIVYGVKTKEI RQRILRLFLVTTHTSDH

    References:
  1. Zhang,X. & Firestein,S. (2002) Nat. Neurosci.
  2. Niimura,Y. & Nei,M. (2003) P.N.A.S.

KNOWN LIGANDS

PubChem
Id
Ligand Name Iupac Name Molecular
Formula
H Bond
Donor
H Bond
Acceptor
Affinity
8158NONANOIC ACIDnonanoic acidC9H18O212100 ┬ÁM